PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.1961s0035.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family TALE
Protein Properties Length: 539aa    MW: 60751.2 Da    PI: 6.117
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.1961s0035.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.75.5e-103714081954
                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          Fe   ++yp+++e+  LAk++gL+++qV +WF N R +
  Cagra.1961s0035.1.p 371 FEHflHPYPKESEKIMLAKQTGLSKNQVANWFINARVR 408
                          664459******************************88 PP

2BELL121.82.8e-39231302172
                 BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                          er+elq+kk+kLl++++eVdkrY+qy++q+++++ssFe+vaglgsakpYts+Al++iSrhFr+L+dai+eqi
  Cagra.1961s0035.1.p 231 EREELQNKKNKLLTMVDEVDKRYNQYYHQMEALASSFEIVAGLGSAKPYTSVALNRISRHFRALRDAIKEQI 302
                          799********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.6E-51156300IPR006563POX domain
PfamPF075261.4E-46162298IPR006563POX domain
PROSITE profilePS5007112.455349412IPR001356Homeobox domain
SMARTSM003895.4E-10352416IPR001356Homeobox domain
CDDcd000865.19E-12352413No hitNo description
SuperFamilySSF466891.75E-17353419IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-28355418IPR009057Homeodomain-like
PfamPF059206.7E-18369408IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 539 aa     Download sequence    Send to blast
MAVYYTSNVG CYQQEPIFLN HQQQQQQQAS SSSAAASFTV TGGDNVRNEM VFIPPTTGDA  60
VTVNGAVSSS DLSFHDGQGL SLSLGTQISV PPFQYHQYQL GFTQNPSLSV KETSTFNVDD  120
MSVKSKDILL LGQSDPSSGY AGNGFFNNYR YNETSGGFMS GVLRSRYLKP AQNLLDEVVS  180
VKKELNQMGK KKMKVNDFNN NGSKEIEGGR GGSGELSSDS NGKSIELSTN EREELQNKKN  240
KLLTMVDEVD KRYNQYYHQM EALASSFEIV AGLGSAKPYT SVALNRISRH FRALRDAIKE  300
QIQIIRDKLG EKGGESLDEQ QGERIPRLRY LDQRLRQQRA LHQQLGMVRP AWRPQRGLPE  360
NSVSVLRAWL FEHFLHPYPK ESEKIMLAKQ TGLSKNQVAN WFINARVRLW KPMIEEMYKE  420
EFGDESELLI SKSSQEPNST NQEDSSSQQH QQENNNNNLG YSSVDTTNIA FSSEIKPDRI  480
SGNDDEPQQQ QQQMNRSADY DTLMNYQGFG LDDYRYIGGS NQQESRFSNS HHLHDFVV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A4e-16358416563Homeobox protein Meis2
3k2a_B4e-16358416563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5705080.0AY570508.1 Arabidopsis thaliana BEL1-like homeodomain 5 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006307208.10.0hypothetical protein CARUB_v10008805mg
SwissprotQ9FXG80.0BLH10_ARATH; BEL1-like homeodomain protein 10
TrEMBLR0GWD70.0R0GWD7_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.1__2150__AT1G19700.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19700.30.0BEL1-like homeodomain 10